(data stored in ACNUC7421 zone)

EMBL: AP011115.PE442

AP011115.PE442       Location/Qualifiers
FT   CDS             complement(452661..453962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48689"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL2"
FT                   /protein_id="BAH48689.1"
FT                   /translation="MAEIRVSASEVRLALSRFERFAGLHGNVAVPMPLIRGAEVIADPF
FT                   ANIRGVRAPGLGIPRRLCIGTWRGRGVRSFVAARAGVPAIRVRTLGRGAGAEFDELIVT
FT                   VSDPGHVVAQIRDVLDPGRVRAVEREVRFRSGDGTLLAGTATVPAGAEGGPAAVILTGS
FT                   GRLDRDGDHAKLPIGVSRALADALARAGVASLRYDKRGVARSGGDYLSTGLSDNIADAA
FT                   AAVDWLRTTGGFGRSSIAVIGHSEGACLAVALGADRGVDPAAVVLLACPAVTGRQVLQW
FT                   QSGEAVDGLPSAVRVVLRALRIDVKERQRVALEKLSRTTTDAARMGGRRVNARWFREFL
FT                   DFDPKPLLRENLAPVLVITGAKDVQVDPEDLAVIAELVPGGADTVQVPDLTHLIRRDAD
FT                   PPSLRAYRRLVRDAVDPEVLSLVADWTAGHLRRV"
     MAEIRVSASE VRLALSRFER FAGLHGNVAV PMPLIRGAEV IADPFANIRG VRAPGLGIPR        60
     RLCIGTWRGR GVRSFVAARA GVPAIRVRTL GRGAGAEFDE LIVTVSDPGH VVAQIRDVLD       120
     PGRVRAVERE VRFRSGDGTL LAGTATVPAG AEGGPAAVIL TGSGRLDRDG DHAKLPIGVS       180
     RALADALARA GVASLRYDKR GVARSGGDYL STGLSDNIAD AAAAVDWLRT TGGFGRSSIA       240
     VIGHSEGACL AVALGADRGV DPAAVVLLAC PAVTGRQVLQ WQSGEAVDGL PSAVRVVLRA       300
     LRIDVKERQR VALEKLSRTT TDAARMGGRR VNARWFREFL DFDPKPLLRE NLAPVLVITG       360
     AKDVQVDPED LAVIAELVPG GADTVQVPDL THLIRRDADP PSLRAYRRLV RDAVDPEVLS       420
     LVADWTAGHL RRV                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page