(data stored in ACNUC7421 zone)

EMBL: AP011115.PE443

AP011115.PE443       Location/Qualifiers
FT   CDS             complement(454130..454615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48690"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL3"
FT                   /protein_id="BAH48690.1"
FT                   /translation="MPVTNVSQDTDALTLTITAEFAAPRARIWQIYADPRQLEKVWGPP
FT                   TYPATVVDHEFAAGGRVTYFMTGPEGEKYAGYWNIISVDEPTGFTFTDGFADADFTPIE
FT                   SMPVSTNEFSFAEKDGSTVATYVSTYATAEGLQKVLDMGVVEGSSQAIGQIDDLIKG"
     MPVTNVSQDT DALTLTITAE FAAPRARIWQ IYADPRQLEK VWGPPTYPAT VVDHEFAAGG        60
     RVTYFMTGPE GEKYAGYWNI ISVDEPTGFT FTDGFADADF TPIESMPVST NEFSFAEKDG       120
     STVATYVSTY ATAEGLQKVL DMGVVEGSSQ AIGQIDDLIK G                           161
//

If you have problems or comments...

PBIL Back to PBIL home page