(data stored in ACNUC7421 zone)

EMBL: AP011115.PE445

AP011115.PE445       Location/Qualifiers
FT   CDS             complement(455356..455670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48692"
FT                   /db_xref="GOA:C1ARL5"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL5"
FT                   /protein_id="BAH48692.1"
FT                   /translation="MRRASSGVEGNGMFGTGLGAMVGLLVVALLVVPVSFGVAARADAK
FT                   ARRLSESPASDANEGLSVAVAEMTGRCDQWRQLATQAWLICGGASLVAVVVVGVLICVG
FT                   "
     MRRASSGVEG NGMFGTGLGA MVGLLVVALL VVPVSFGVAA RADAKARRLS ESPASDANEG        60
     LSVAVAEMTG RCDQWRQLAT QAWLICGGAS LVAVVVVGVL ICVG                        104
//

If you have problems or comments...

PBIL Back to PBIL home page