(data stored in ACNUC7421 zone)

EMBL: AP011115.PE446

AP011115.PE446       Location/Qualifiers
FT   CDS             complement(455804..456010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48693"
FT                   /db_xref="GOA:C1ARL6"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL6"
FT                   /protein_id="BAH48693.1"
FT                   /translation="MYGVHRHRRGSQEPLHVKERVVMARISKKSGADLLDALRVSVIGT
FT                   VVCAGLVMGVIVVTMWNFPVPGV"
     MYGVHRHRRG SQEPLHVKER VVMARISKKS GADLLDALRV SVIGTVVCAG LVMGVIVVTM        60
     WNFPVPGV                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page