(data stored in ACNUC7421 zone)

EMBL: AP011115.PE447

AP011115.PE447       Location/Qualifiers
FT   CDS             complement(456609..457211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48694"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL7"
FT                   /protein_id="BAH48694.1"
FT                   /translation="MMTRLQVAIAVIVGYWLGRTHHTKPGMMLAAAGAGRLAGSPQEMV
FT                   DHAAKLLQASPEFAALDESVRGQLLDAVRVAAVTAGTARADVDTDIDRLLPSGSDDALR
FT                   TAEDLAEDTAALVDDIPAAAPVEDVPDDIDADIDIDTDNDAQADDAPTADDGNAAAPAP
FT                   STAEVRTWAREHGFPVSDRGRLRAEVWEAFAAAHPER"
     MMTRLQVAIA VIVGYWLGRT HHTKPGMMLA AAGAGRLAGS PQEMVDHAAK LLQASPEFAA        60
     LDESVRGQLL DAVRVAAVTA GTARADVDTD IDRLLPSGSD DALRTAEDLA EDTAALVDDI       120
     PAAAPVEDVP DDIDADIDID TDNDAQADDA PTADDGNAAA PAPSTAEVRT WAREHGFPVS       180
     DRGRLRAEVW EAFAAAHPER                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page