(data stored in ACNUC7421 zone)

EMBL: AP011115.PE448

AP011115.PE448       Location/Qualifiers
FT   CDS             457418..458605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04480"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48695"
FT                   /db_xref="GOA:C1ARL8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL8"
FT                   /protein_id="BAH48695.1"
FT                   /translation="MTEGRSGRAAAAHRRMRPLYAAGFTTAFGAHAVAANLAFDLEDPA
FT                   GSLLYLGLLLALYDGAEVLLKPVFGTLADRIGARPVLLGGLIGFAAASVFFVVVGDSSW
FT                   LWLARLGQGVAASAFSPAASALVARMTPKAAHGSAFGTYGFYKGLGYTIGPLLGGALVW
FT                   LGDLTLLFAVMTALAVTVAAWAARVVPALPPLPRNRQTVLDLARRLSDRTFLRPTLALA
FT                   FATSALSVGVGFLPVAGAAAGLGSVATGAAVSVLAACAALVQPRAGRALDAGRISAGPG
FT                   TALGLLITATGLGCAMLPGLLGVLLAALAIGTGTGLITPLAFASLAGSTPDERMGQTMG
FT                   AAELGRELGDAGGPLLVGGIAAVATLTVGFGALAALTLVAGAVTAAAGSARAGQP"
     MTEGRSGRAA AAHRRMRPLY AAGFTTAFGA HAVAANLAFD LEDPAGSLLY LGLLLALYDG        60
     AEVLLKPVFG TLADRIGARP VLLGGLIGFA AASVFFVVVG DSSWLWLARL GQGVAASAFS       120
     PAASALVARM TPKAAHGSAF GTYGFYKGLG YTIGPLLGGA LVWLGDLTLL FAVMTALAVT       180
     VAAWAARVVP ALPPLPRNRQ TVLDLARRLS DRTFLRPTLA LAFATSALSV GVGFLPVAGA       240
     AAGLGSVATG AAVSVLAACA ALVQPRAGRA LDAGRISAGP GTALGLLITA TGLGCAMLPG       300
     LLGVLLAALA IGTGTGLITP LAFASLAGST PDERMGQTMG AAELGRELGD AGGPLLVGGI       360
     AAVATLTVGF GALAALTLVA GAVTAAAGSA RAGQP                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page