(data stored in ACNUC7421 zone)

EMBL: AP011115.PE449

AP011115.PE449       Location/Qualifiers
FT   CDS             complement(458644..458910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04490"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48696"
FT                   /db_xref="GOA:C1ARL9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL9"
FT                   /protein_id="BAH48696.1"
FT                   /translation="MVRSPLTPQQRAAGKRLGAYLRQARGDRKPAEVAHAASISPETLR
FT                   KIETGRLATPAFTTVAALAAVLAVPLEDLAQICLPELNLQQTG"
     MVRSPLTPQQ RAAGKRLGAY LRQARGDRKP AEVAHAASIS PETLRKIETG RLATPAFTTV        60
     AALAAVLAVP LEDLAQICLP ELNLQQTG                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page