(data stored in ACNUC7421 zone)

EMBL: AP011115.PE45

AP011115.PE45        Location/Qualifiers
FT   CDS             complement(37305..37838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48292"
FT                   /db_xref="GOA:C1AS43"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS43"
FT                   /protein_id="BAH48292.1"
FT                   /translation="MTGTNEDTPMTRRPARRISVLQAITEGIPTSSRWGRVDVTPLQIA
FT                   QQQRSIRATLSIYPPGVTSRERTLMHLRKLGTTWVGLLGYLAVLVVAGIVLGVLGAAMA
FT                   IAVLIALWAGIALATSGVNKDTRCLRIYARPGSVGGEMARLEEIATELDALDTANLDPV
FT                   SYEAEWGRIYRQLA"
     MTGTNEDTPM TRRPARRISV LQAITEGIPT SSRWGRVDVT PLQIAQQQRS IRATLSIYPP        60
     GVTSRERTLM HLRKLGTTWV GLLGYLAVLV VAGIVLGVLG AAMAIAVLIA LWAGIALATS       120
     GVNKDTRCLR IYARPGSVGG EMARLEEIAT ELDALDTANL DPVSYEAEWG RIYRQLA          177
//

If you have problems or comments...

PBIL Back to PBIL home page