(data stored in ACNUC7421 zone)

EMBL: AP011115.PE452

AP011115.PE452       Location/Qualifiers
FT   CDS             461290..461877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48699"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM2"
FT                   /protein_id="BAH48699.1"
FT                   /translation="MRAGFPDFRLGNVLATSFTGTLSERHGNAVERIPTPHRLVDWLAA
FT                   NGLVVDFCTTTQLELARELRESIHAASTAVASQDDLPASAVRVINDCSIRGRAAAILTP
FT                   EGNRRWRLSSPSCVEDALGVIAADAISIIAGERDGKFALCASPTCRAAFFDTSQSRTRK
FT                   WCDMNTCGNRQKKARFNANHRKNPDAPRAPRI"
     MRAGFPDFRL GNVLATSFTG TLSERHGNAV ERIPTPHRLV DWLAANGLVV DFCTTTQLEL        60
     ARELRESIHA ASTAVASQDD LPASAVRVIN DCSIRGRAAA ILTPEGNRRW RLSSPSCVED       120
     ALGVIAADAI SIIAGERDGK FALCASPTCR AAFFDTSQSR TRKWCDMNTC GNRQKKARFN       180
     ANHRKNPDAP RAPRI                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page