(data stored in ACNUC7421 zone)

EMBL: AP011115.PE456

AP011115.PE456       Location/Qualifiers
FT   CDS             complement(465612..466115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM6"
FT                   /protein_id="BAH48703.1"
FT                   /translation="MANQTRWSWPAVGVALIAVAAVTWLAAVVIADVRRAPDAECLAVD
FT                   STVTDLIASRPVADPIEPVDAVAVRDPWTRSSGSVPFDNYYAIAMEFRSSDGSISHGVW
FT                   GLGTDAAPAEGRALTAHADNALGAPFVSVDQLARQSTLWPDTAMFFPEDANAVREARRC
FT                   LTFQ"
     MANQTRWSWP AVGVALIAVA AVTWLAAVVI ADVRRAPDAE CLAVDSTVTD LIASRPVADP        60
     IEPVDAVAVR DPWTRSSGSV PFDNYYAIAM EFRSSDGSIS HGVWGLGTDA APAEGRALTA       120
     HADNALGAPF VSVDQLARQS TLWPDTAMFF PEDANAVREA RRCLTFQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page