(data stored in ACNUC7421 zone)

EMBL: AP011115.PE457

AP011115.PE457       Location/Qualifiers
FT   CDS             466296..466913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48704"
FT                   /db_xref="GOA:C1ARM7"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM7"
FT                   /protein_id="BAH48704.1"
FT                   /translation="MDGPVARAFDSAARRFLEVSAAATGHYDAPGLGEWSVRDLVGHTS
FT                   RSLSTVETYLDAAGEDPGAVELTDAVAYYLAIADALSDTAAVAQRGREAGAALGEDPMG
FT                   ALSALVARVPERVRASPSTALVRTPFGTMTLQGYLPTRTLELTVHTCDLAAALGVDADV
FT                   PREAVAETFAVIGGLAAVQGTAPAALLALTGRSPLPAGYSVL"
     MDGPVARAFD SAARRFLEVS AAATGHYDAP GLGEWSVRDL VGHTSRSLST VETYLDAAGE        60
     DPGAVELTDA VAYYLAIADA LSDTAAVAQR GREAGAALGE DPMGALSALV ARVPERVRAS       120
     PSTALVRTPF GTMTLQGYLP TRTLELTVHT CDLAAALGVD ADVPREAVAE TFAVIGGLAA       180
     VQGTAPAALL ALTGRSPLPA GYSVL                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page