(data stored in ACNUC7421 zone)

EMBL: AP011115.PE458

AP011115.PE458       Location/Qualifiers
FT   CDS             complement(466983..467465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48705"
FT                   /db_xref="GOA:C1ARM8"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM8"
FT                   /protein_id="BAH48705.1"
FT                   /translation="MEIVVRAAVLFLFLWVITRVVGRSTVGELSTFQLVLYVVMGDLVQ
FT                   QGVTQQDYSVTSAVLAVGVFALLTLALAWANARFPRVRGVTHGVPVIIVRDGIPDLDRL
FT                   RTERMSLDDLMADARQKGIRRFDEIELAVLETNGRVSFFTRTGHTDAGAPEQPGIA"
     MEIVVRAAVL FLFLWVITRV VGRSTVGELS TFQLVLYVVM GDLVQQGVTQ QDYSVTSAVL        60
     AVGVFALLTL ALAWANARFP RVRGVTHGVP VIIVRDGIPD LDRLRTERMS LDDLMADARQ       120
     KGIRRFDEIE LAVLETNGRV SFFTRTGHTD AGAPEQPGIA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page