(data stored in ACNUC7421 zone)

EMBL: AP011115.PE459

AP011115.PE459       Location/Qualifiers
FT   CDS             complement(467465..467995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48706"
FT                   /db_xref="GOA:C1ARM9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM9"
FT                   /protein_id="BAH48706.1"
FT                   /translation="MRPSDRIPASVFDDVREYARTPAVAWLRRAAVALLALIVAFGAVG
FT                   LLGVRSGTAYAEGGGYALTLTYPRVARAGLDVPWDLTVRKPGGFSEPVVIVVDSDYFDM
FT                   FETQGWTPEPSAETSDALRTYMTVDPPPGDTLTLGFDAYIQPSSQLGHSGSVSVSEKGV
FT                   DVATLEFTTWLVP"
     MRPSDRIPAS VFDDVREYAR TPAVAWLRRA AVALLALIVA FGAVGLLGVR SGTAYAEGGG        60
     YALTLTYPRV ARAGLDVPWD LTVRKPGGFS EPVVIVVDSD YFDMFETQGW TPEPSAETSD       120
     ALRTYMTVDP PPGDTLTLGF DAYIQPSSQL GHSGSVSVSE KGVDVATLEF TTWLVP           176
//

If you have problems or comments...

PBIL Back to PBIL home page