(data stored in ACNUC7421 zone)

EMBL: AP011115.PE460

AP011115.PE460       Location/Qualifiers
FT   CDS             complement(468621..468992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48707"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN0"
FT                   /protein_id="BAH48707.1"
FT                   /translation="MWRNAHVPSYLLGMPPRYHVTSVLNRASIFRYGLDFSRMGAARGI
FT                   AGSSGPEQKGCFLAADEWERDWFVRMNNTGGAVDVWEVHGINDDDLIESPEGHYFFPGV
FT                   IAAAKLRLVQRDLPPSRNY"
     MWRNAHVPSY LLGMPPRYHV TSVLNRASIF RYGLDFSRMG AARGIAGSSG PEQKGCFLAA        60
     DEWERDWFVR MNNTGGAVDV WEVHGINDDD LIESPEGHYF FPGVIAAAKL RLVQRDLPPS       120
     RNY                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page