(data stored in ACNUC7421 zone)

EMBL: AP011115.PE461

AP011115.PE461       Location/Qualifiers
FT   CDS             469176..469505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48708"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN1"
FT                   /protein_id="BAH48708.1"
FT                   /translation="MHRSTAGGRFGPVRLIERDSDFAVVFAADTTRWVVLVQAGGDSPK
FT                   ASVILGVPNPGVGFGRSLRASYLQRLTVHRSGDPSVARKPPEFGWMALAGIAAEGVSQF
FT                   EVRSS"
     MHRSTAGGRF GPVRLIERDS DFAVVFAADT TRWVVLVQAG GDSPKASVIL GVPNPGVGFG        60
     RSLRASYLQR LTVHRSGDPS VARKPPEFGW MALAGIAAEG VSQFEVRSS                   109
//

If you have problems or comments...

PBIL Back to PBIL home page