(data stored in ACNUC7421 zone)

EMBL: AP011115.PE462

AP011115.PE462       Location/Qualifiers
FT   CDS             469686..469955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48709"
FT                   /db_xref="GOA:C1ARN2"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN2"
FT                   /protein_id="BAH48709.1"
FT                   /translation="MATKDSQPQLKDQEMYEELREMGDSKEKAARISNAAAARGRKNVG
FT                   KSGGKSQSYDDWTVDELEKRAKELGLKGYSKLNKKELIDELRNH"
     MATKDSQPQL KDQEMYEELR EMGDSKEKAA RISNAAAARG RKNVGKSGGK SQSYDDWTVD        60
     ELEKRAKELG LKGYSKLNKK ELIDELRNH                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page