(data stored in ACNUC7421 zone)

EMBL: AP011115.PE463

AP011115.PE463       Location/Qualifiers
FT   CDS             470033..470398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN3"
FT                   /protein_id="BAH48710.1"
FT                   /translation="MQKVLTFAAGAAVGFVLGTRSGRQTYEKMRHQSLELWHNPTVQEK
FT                   VSEATDTVKDKAPQVQHKVGELAKKATHRHTDTHSTTAPTNGASLGDAPTPPPAAPTPT
FT                   DAETTTGVPPTRGESAG"
     MQKVLTFAAG AAVGFVLGTR SGRQTYEKMR HQSLELWHNP TVQEKVSEAT DTVKDKAPQV        60
     QHKVGELAKK ATHRHTDTHS TTAPTNGASL GDAPTPPPAA PTPTDAETTT GVPPTRGESA       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page