(data stored in ACNUC7421 zone)

EMBL: AP011115.PE464

AP011115.PE464       Location/Qualifiers
FT   CDS             complement(470435..470932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48711"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN4"
FT                   /protein_id="BAH48711.1"
FT                   /translation="MGTRTPWHPVPHHPGVLPSAPLCARRCGAGSDSAYAKYPQSIDAV
FT                   AAEYRLTGTRGADFWGNSVTSTADTVTFLEAKTTDPSSPILGWMATAAPVAVDGTRQNG
FT                   GTGALPSVTGTKWGWSDDGSSVVASASFGPDFSVAANTYGTAEQHTSDVLGAFGLEPTP
FT                   PA"
     MGTRTPWHPV PHHPGVLPSA PLCARRCGAG SDSAYAKYPQ SIDAVAAEYR LTGTRGADFW        60
     GNSVTSTADT VTFLEAKTTD PSSPILGWMA TAAPVAVDGT RQNGGTGALP SVTGTKWGWS       120
     DDGSSVVASA SFGPDFSVAA NTYGTAEQHT SDVLGAFGLE PTPPA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page