(data stored in ACNUC7421 zone)

EMBL: AP011115.PE468

AP011115.PE468       Location/Qualifiers
FT   CDS             474144..475301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04680"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48715"
FT                   /db_xref="GOA:C1ARN8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN8"
FT                   /protein_id="BAH48715.1"
FT                   /translation="MADLCSPTFDQLSTALGFSCAEAGGLVEVRSPLALENWTLPVLEL
FT                   TIVLGSVLALVFAVLRWRRNGDPTTLALWFGATAYLFVIEPPLYFPAAFGIEEHVDTMF
FT                   AHNVFTVDFLWGRLPLYIIAIYPLMATLAFELVRMLGVFRKYGVLVGAVCVGFVHHAFY
FT                   EIFDQLGPQLRWWEWSTTNPVNQPMFDAVPLPSVVVFAALWPMSLAMCVQFFVGRHADR
FT                   GRKFTGLELAWRTIVIGLLASAGTFILPLPATVLGMESTTVRGVFYAAELAVVALVAIP
FT                   VLVRQWSRLRGGTSDVPSYSNDFVRAYSVVYLGVMGMLWLTALPDYFAAVDGVTSNGDP
FT                   IGNIWYTIVCFAIAVLCVAATFTVPRNSVNGHGAVSGERTPDAVR"
     MADLCSPTFD QLSTALGFSC AEAGGLVEVR SPLALENWTL PVLELTIVLG SVLALVFAVL        60
     RWRRNGDPTT LALWFGATAY LFVIEPPLYF PAAFGIEEHV DTMFAHNVFT VDFLWGRLPL       120
     YIIAIYPLMA TLAFELVRML GVFRKYGVLV GAVCVGFVHH AFYEIFDQLG PQLRWWEWST       180
     TNPVNQPMFD AVPLPSVVVF AALWPMSLAM CVQFFVGRHA DRGRKFTGLE LAWRTIVIGL       240
     LASAGTFILP LPATVLGMES TTVRGVFYAA ELAVVALVAI PVLVRQWSRL RGGTSDVPSY       300
     SNDFVRAYSV VYLGVMGMLW LTALPDYFAA VDGVTSNGDP IGNIWYTIVC FAIAVLCVAA       360
     TFTVPRNSVN GHGAVSGERT PDAVR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page