(data stored in ACNUC7421 zone)

EMBL: AP011115.PE469

AP011115.PE469       Location/Qualifiers
FT   CDS             complement(475911..479861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04690"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48716"
FT                   /db_xref="GOA:C1ARN9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN9"
FT                   /protein_id="BAH48716.1"
FT                   /translation="MEHAARATYREHRSDPFPLSAAQHGLWFAQQLAPDVPICIAQYVD
FT                   IRGPLDVELFREVALVAGHEYESVFLRLIDVDGEPHQVIDPPADAAMGVVDFRGASDPM
FT                   AAAETWMHDNYTARVDFEHDHLCESSLLCVGDERHLWYSRIHHVALDGYAAMTLVNRVA
FT                   ALYTAAVEDRALEPNRAADLHTLHRLEEDYRASHRFTSDRDYWAERLHRRTNGASLTDV
FT                   EAPPAAHSLTVRAALSPDTVARLEDTGGRPGATAAAALIAAFACHLSRRTGQEEVLVDI
FT                   PLSARTTAVLRRSSGMLANVAPLLVQVRSGDTVGDLVARVQHELMGAMRHQRGNVEDIL
FT                   RDLGVSAESRRISGPMVNVMLFDQDLTFGSLTGDFRILTTGPVPDLSVNVYRSGTPAST
FT                   IVEFEANPYRYREDELRSHHAAVVGLIDDVLAADPDTPLAAIGVADVGRLTPVVGGLSV
FT                   SEVSLPELLAAAVAVDPDAVAVVCEGRGLSYRELDEASNRLARVLLGSGVGCESVVAVA
FT                   VGRSVESVLSVWAVAKTGAAFVPVDPGYPVGRIEHMVADSGVVVGVTLSGSVAVLPGGV
FT                   RWVVLDDVETVEWLSSVSAGPVTDGDRGAPVRVGQAAYVIYTSGSTGLPKGVVVSHRGL
FT                   ANVVASQRAGFGGGVGARVLQCASPSFDASVFELVWAVGLGGRLVVVPPTVYGGEELAR
FT                   ILVSEGVTHAVLTPTALSSLDPSGLEALGALVVAGEVCPPELVARWAPGRSMFNAYGPT
FT                   ESTIMSNASDGLVVGESVTIGGPVRGFGELVLDARLRPVPVGAVGELYLSGPGLARGYR
FT                   NRVGLTSARFVADPFGVPGQRMYRTGDVVRWREGAGGGLVLEYVGRADFQVKIRGFRVE
FT                   LGEIESALLGYPGIDHAVVHTSGDRLAGYVVPVAGSDLDTSAVLAHARTRLAPHMVPAT
FT                   VTVLDAVPVTANGKLDRAALPEPDFTAGRAEYRAPRNATEEMVAAAFAGGLGLDRVGLD
FT                   DNYFALGGTSLTATSVIARIAEDAARAVPVQWIFTHPTPEALAHMIATAPEDARAGDTA
FT                   DRSLDVLLPLRTTGTGSPVFCIHPAIGLAWCFTGLVQYLGDRPVYGLQSPALTDPDLRI
FT                   DSLQELAGRYVDRIRSVQPHGPYHLVGYSVGGQIAHEMAVQLTGAGDEVATLTMLDTHL
FT                   AGGLDRTAEKPTMAALLAEFGAVVPRDGDDATTTERAVEVLRRTGGPFAAVTADDLDAV
FT                   HRVFTQTVDLALAHRPSTPSGVDLLYFGAADSVDAPTGVSAWRQHITGEILVHHVPAAH
FT                   QQMTSPEALAGIGPVLAHHVLLADKPMRVVSS"
     MEHAARATYR EHRSDPFPLS AAQHGLWFAQ QLAPDVPICI AQYVDIRGPL DVELFREVAL        60
     VAGHEYESVF LRLIDVDGEP HQVIDPPADA AMGVVDFRGA SDPMAAAETW MHDNYTARVD       120
     FEHDHLCESS LLCVGDERHL WYSRIHHVAL DGYAAMTLVN RVAALYTAAV EDRALEPNRA       180
     ADLHTLHRLE EDYRASHRFT SDRDYWAERL HRRTNGASLT DVEAPPAAHS LTVRAALSPD       240
     TVARLEDTGG RPGATAAAAL IAAFACHLSR RTGQEEVLVD IPLSARTTAV LRRSSGMLAN       300
     VAPLLVQVRS GDTVGDLVAR VQHELMGAMR HQRGNVEDIL RDLGVSAESR RISGPMVNVM       360
     LFDQDLTFGS LTGDFRILTT GPVPDLSVNV YRSGTPASTI VEFEANPYRY REDELRSHHA       420
     AVVGLIDDVL AADPDTPLAA IGVADVGRLT PVVGGLSVSE VSLPELLAAA VAVDPDAVAV       480
     VCEGRGLSYR ELDEASNRLA RVLLGSGVGC ESVVAVAVGR SVESVLSVWA VAKTGAAFVP       540
     VDPGYPVGRI EHMVADSGVV VGVTLSGSVA VLPGGVRWVV LDDVETVEWL SSVSAGPVTD       600
     GDRGAPVRVG QAAYVIYTSG STGLPKGVVV SHRGLANVVA SQRAGFGGGV GARVLQCASP       660
     SFDASVFELV WAVGLGGRLV VVPPTVYGGE ELARILVSEG VTHAVLTPTA LSSLDPSGLE       720
     ALGALVVAGE VCPPELVARW APGRSMFNAY GPTESTIMSN ASDGLVVGES VTIGGPVRGF       780
     GELVLDARLR PVPVGAVGEL YLSGPGLARG YRNRVGLTSA RFVADPFGVP GQRMYRTGDV       840
     VRWREGAGGG LVLEYVGRAD FQVKIRGFRV ELGEIESALL GYPGIDHAVV HTSGDRLAGY       900
     VVPVAGSDLD TSAVLAHART RLAPHMVPAT VTVLDAVPVT ANGKLDRAAL PEPDFTAGRA       960
     EYRAPRNATE EMVAAAFAGG LGLDRVGLDD NYFALGGTSL TATSVIARIA EDAARAVPVQ      1020
     WIFTHPTPEA LAHMIATAPE DARAGDTADR SLDVLLPLRT TGTGSPVFCI HPAIGLAWCF      1080
     TGLVQYLGDR PVYGLQSPAL TDPDLRIDSL QELAGRYVDR IRSVQPHGPY HLVGYSVGGQ      1140
     IAHEMAVQLT GAGDEVATLT MLDTHLAGGL DRTAEKPTMA ALLAEFGAVV PRDGDDATTT      1200
     ERAVEVLRRT GGPFAAVTAD DLDAVHRVFT QTVDLALAHR PSTPSGVDLL YFGAADSVDA      1260
     PTGVSAWRQH ITGEILVHHV PAAHQQMTSP EALAGIGPVL AHHVLLADKP MRVVSS          1316
//

If you have problems or comments...

PBIL Back to PBIL home page