(data stored in ACNUC7421 zone)

EMBL: AP011115.PE47

AP011115.PE47        Location/Qualifiers
FT   CDS             39058..39471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00470"
FT                   /product="putative WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48294"
FT                   /db_xref="GOA:C1AS45"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS45"
FT                   /protein_id="BAH48294.1"
FT                   /translation="MPDHFHHSPDRDWPHRASCRGTDTNLFFSPDGERGNVRARRERAA
FT                   KQICQDCPVLAQCRAHALTTTETYGIWGGMSETERTRHTRRTRVPARHRDATPAPAPQP
FT                   PPLYLLAHVTNACAAKPVPPVTAPPSEPANVSP"
     MPDHFHHSPD RDWPHRASCR GTDTNLFFSP DGERGNVRAR RERAAKQICQ DCPVLAQCRA        60
     HALTTTETYG IWGGMSETER TRHTRRTRVP ARHRDATPAP APQPPPLYLL AHVTNACAAK       120
     PVPPVTAPPS EPANVSP                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page