(data stored in ACNUC7421 zone)

EMBL: AP011115.PE475

AP011115.PE475       Location/Qualifiers
FT   CDS             482495..482872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48722"
FT                   /db_xref="GOA:C1ARP5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP5"
FT                   /protein_id="BAH48722.1"
FT                   /translation="MLNSEISNPVRSTRSFLDRRRGPSDRELVTTAKAVLITRRGYSDA
FT                   QAFDELLDVARRHHLSVQGAARCLIDLTSNTGHLTSRRPVTFPEWEGLRGQPSGHHRRP
FT                   SQRMDSLQGRHHPHLATQIRP"
     MLNSEISNPV RSTRSFLDRR RGPSDRELVT TAKAVLITRR GYSDAQAFDE LLDVARRHHL        60
     SVQGAARCLI DLTSNTGHLT SRRPVTFPEW EGLRGQPSGH HRRPSQRMDS LQGRHHPHLA       120
     TQIRP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page