(data stored in ACNUC7421 zone)

EMBL: AP011115.PE477

AP011115.PE477       Location/Qualifiers
FT   CDS             complement(484082..484750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48724"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP7"
FT                   /protein_id="BAH48724.1"
FT                   /translation="MAVGATRRRPRRRMPIVYARSSTFDAHPSFIDEGIKHVRDTVMPA
FT                   LADIAGSAGMSLLVDRGSGRCIATSSWTDDEALRASEAPVRQLRDRMAEVFHATATVAR
FT                   WDIAALHRDHRSHHGAWVRVAWLDVEPGHLDRVIDVYKMSSLPAMHELAGFCSASLLVD
FT                   PAAGRVVSSMTFDSAPAEAGARDAVESIGTSEIRESGARLLEVGEFELAIAHLHVPEMA
FT                   "
     MAVGATRRRP RRRMPIVYAR SSTFDAHPSF IDEGIKHVRD TVMPALADIA GSAGMSLLVD        60
     RGSGRCIATS SWTDDEALRA SEAPVRQLRD RMAEVFHATA TVARWDIAAL HRDHRSHHGA       120
     WVRVAWLDVE PGHLDRVIDV YKMSSLPAMH ELAGFCSASL LVDPAAGRVV SSMTFDSAPA       180
     EAGARDAVES IGTSEIRESG ARLLEVGEFE LAIAHLHVPE MA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page