(data stored in ACNUC7421 zone)

EMBL: AP011115.PE479

AP011115.PE479       Location/Qualifiers
FT   CDS             complement(485032..485361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48726"
FT                   /db_xref="GOA:C1ARP9"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP9"
FT                   /protein_id="BAH48726.1"
FT                   /translation="MIEDSTEPSLTPVPSPTRLIPRRRPDGRELLGTAKGILIAGRGCT
FT                   DAQAFDELLDVARRHHLTVLGAARSLVELAAGPSPRPRRADTARFDEWEQLVAQLPPRR
FT                   HAQAS"
     MIEDSTEPSL TPVPSPTRLI PRRRPDGREL LGTAKGILIA GRGCTDAQAF DELLDVARRH        60
     HLTVLGAARS LVELAAGPSP RPRRADTARF DEWEQLVAQL PPRRHAQAS                   109
//

If you have problems or comments...

PBIL Back to PBIL home page