(data stored in ACNUC7421 zone)

EMBL: AP011115.PE48

AP011115.PE48        Location/Qualifiers
FT   CDS             39538..40362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00480"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48295"
FT                   /db_xref="GOA:C1AS46"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS46"
FT                   /protein_id="BAH48295.1"
FT                   /translation="MSGTIESSPHDGARVLVVILSAVAAVVGSIIGSGALVGTPISQVA
FT                   DGALAADATAVAPGGPAFSIWTLIYLGFLALAIWQALPAHRTDPRQRRAGWWLAAAMIL
FT                   NAAWIACVQFEQLWLSVLTILALLAVLVVVFHILTNTKPSSRAEAIVVDATAFVYLGWV
FT                   CVAVVANIAAALAAAEIDPFALGADTWAVLVLTAVALVAVVLAVAGHGRFTVTAAIVWG
FT                   LVWIAVARTTGDGFTSQPAAIAALTAAALAIAATAIARLPRARSGEASVTKP"
     MSGTIESSPH DGARVLVVIL SAVAAVVGSI IGSGALVGTP ISQVADGALA ADATAVAPGG        60
     PAFSIWTLIY LGFLALAIWQ ALPAHRTDPR QRRAGWWLAA AMILNAAWIA CVQFEQLWLS       120
     VLTILALLAV LVVVFHILTN TKPSSRAEAI VVDATAFVYL GWVCVAVVAN IAAALAAAEI       180
     DPFALGADTW AVLVLTAVAL VAVVLAVAGH GRFTVTAAIV WGLVWIAVAR TTGDGFTSQP       240
     AAIAALTAAA LAIAATAIAR LPRARSGEAS VTKP                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page