(data stored in ACNUC7421 zone)

EMBL: AP011115.PE480

AP011115.PE480       Location/Qualifiers
FT   CDS             complement(485723..488263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04800"
FT                   /product="UvrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48727"
FT                   /db_xref="GOA:C1ARQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ0"
FT                   /protein_id="BAH48727.1"
FT                   /translation="MPTPDPGPPAEPSPAREFAGIEVFDASEHNLAHVDVFIPRDCIVA
FT                   FTGVSGSGKSSLAFGTIYAEAQRRFLESVTPYARRLMDQVGAPRVGDITGLPPAVALQQ
FT                   ARGHTSARSSVGTLTHISNVLRMLFSRAGTYPPDAAELDSNAFSPNTPEGGCPTCHGLG
FT                   RTHDVDVDALVPDPSRSIRDGAVAAWPGAWLGKNYRDILDTLGIDVDRPWSELPAHQRE
FT                   WILTTDEQPTVTVSPIRDPGKMVRDYQGTFSSARTYVLHTFATTKSATQRAKVSRYLLS
FT                   RPCSACDGKRLRPEALAVRFAGLDIADATALPMSELATALDAAVGSRDAAADDATDRAS
FT                   EALVDNLLGRLRGLSELGLGYLSLGRSTTTLSPGELQRLRLATQLQSGLFGVLYVLDEP
FT                   SAGLHPADTEALVAAVRRLRAAGNSVFVIEHNLDIVRAADWIVDVGPDAGEHGGRVLYS
FT                   GTVDGLAETPESVTRRYLFEPREHRPEPAQPSRWIELSGITMHNLRDLTVRIPLGVLTA
FT                   VTGVSGSGKSTLVSRVLTDVVAQHLGVDDEPGPDTVGDDADSTAVLADGRDTTASTVVS
FT                   SHGLGHIDRLVRVDQTPIGRTPRSNLATYTGLFDVIRKLFAAHPTARERGYSPGRFSFN
FT                   VTGGRCDECEGAGAITIGMLFLPEASAPCPVCAGARYNTETLEILVDGRSIADVLAMTA
FT                   DEAGDFLNHVPAAKKSLDMLVEVGLGYLRLGQSATTLSGGEAQRVKLASELQRIRSGHT
FT                   LYVLDEPTTGLHPADVDRLMVVLRRLVAAKNTVVLVEHDMSVIAAADWMIDLGPGGGDN
FT                   GGRVIASGQPVTVAATADSATAAHLGRHLAPANG"
     MPTPDPGPPA EPSPAREFAG IEVFDASEHN LAHVDVFIPR DCIVAFTGVS GSGKSSLAFG        60
     TIYAEAQRRF LESVTPYARR LMDQVGAPRV GDITGLPPAV ALQQARGHTS ARSSVGTLTH       120
     ISNVLRMLFS RAGTYPPDAA ELDSNAFSPN TPEGGCPTCH GLGRTHDVDV DALVPDPSRS       180
     IRDGAVAAWP GAWLGKNYRD ILDTLGIDVD RPWSELPAHQ REWILTTDEQ PTVTVSPIRD       240
     PGKMVRDYQG TFSSARTYVL HTFATTKSAT QRAKVSRYLL SRPCSACDGK RLRPEALAVR       300
     FAGLDIADAT ALPMSELATA LDAAVGSRDA AADDATDRAS EALVDNLLGR LRGLSELGLG       360
     YLSLGRSTTT LSPGELQRLR LATQLQSGLF GVLYVLDEPS AGLHPADTEA LVAAVRRLRA       420
     AGNSVFVIEH NLDIVRAADW IVDVGPDAGE HGGRVLYSGT VDGLAETPES VTRRYLFEPR       480
     EHRPEPAQPS RWIELSGITM HNLRDLTVRI PLGVLTAVTG VSGSGKSTLV SRVLTDVVAQ       540
     HLGVDDEPGP DTVGDDADST AVLADGRDTT ASTVVSSHGL GHIDRLVRVD QTPIGRTPRS       600
     NLATYTGLFD VIRKLFAAHP TARERGYSPG RFSFNVTGGR CDECEGAGAI TIGMLFLPEA       660
     SAPCPVCAGA RYNTETLEIL VDGRSIADVL AMTADEAGDF LNHVPAAKKS LDMLVEVGLG       720
     YLRLGQSATT LSGGEAQRVK LASELQRIRS GHTLYVLDEP TTGLHPADVD RLMVVLRRLV       780
     AAKNTVVLVE HDMSVIAAAD WMIDLGPGGG DNGGRVIASG QPVTVAATAD SATAAHLGRH       840
     LAPANG                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page