(data stored in ACNUC7421 zone)

EMBL: AP011115.PE484

AP011115.PE484       Location/Qualifiers
FT   CDS             complement(492306..493754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48731"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ4"
FT                   /protein_id="BAH48731.1"
FT                   /translation="MPITQQWELRAEFARRLSHLYGKEVPAYTALLEVSRAVNDTVLSN
FT                   LGAGAQRLGSTARITAERHGAIRVGTPQEMAQVARVFAAMGMYPVGFYDLREAAASSVP
FT                   VVSTAFRPTDPDELARNPFRVFTSMLVPSDRRFFSAELQQRLESFLAQRRLFTAELLVL
FT                   ADRATEYRGLNSGDAEMFLTLATAAFKLSTEAVDRAWYRELEQVSSVAADIGGVTSTHI
FT                   NHLTPRVLDIDDLYARMERRRIDMIDTIQGPPRWAGPDLLLRQTSFRALAEPRVFREAD
FT                   GSVEKGSLRVRFGEVEARGIAATVRGREVYDRLTGEIEQAVREAAATAPVSAEVRNEIA
FT                   AALWNQQVPATEQGLALHDLAYFTYRVDTDKQRNGTVPGRSLQDLIDQGWVRPEPIVYE
FT                   DFLPKSAAGIFQSNLTSDGHKDTTQSMTDIDAAWMEGVLGRTLHDPYALYDGIRRVSLD
FT                   HVASQLGIRGPIDVPAPIATRGVK"
     MPITQQWELR AEFARRLSHL YGKEVPAYTA LLEVSRAVND TVLSNLGAGA QRLGSTARIT        60
     AERHGAIRVG TPQEMAQVAR VFAAMGMYPV GFYDLREAAA SSVPVVSTAF RPTDPDELAR       120
     NPFRVFTSML VPSDRRFFSA ELQQRLESFL AQRRLFTAEL LVLADRATEY RGLNSGDAEM       180
     FLTLATAAFK LSTEAVDRAW YRELEQVSSV AADIGGVTST HINHLTPRVL DIDDLYARME       240
     RRRIDMIDTI QGPPRWAGPD LLLRQTSFRA LAEPRVFREA DGSVEKGSLR VRFGEVEARG       300
     IAATVRGREV YDRLTGEIEQ AVREAAATAP VSAEVRNEIA AALWNQQVPA TEQGLALHDL       360
     AYFTYRVDTD KQRNGTVPGR SLQDLIDQGW VRPEPIVYED FLPKSAAGIF QSNLTSDGHK       420
     DTTQSMTDID AAWMEGVLGR TLHDPYALYD GIRRVSLDHV ASQLGIRGPI DVPAPIATRG       480
     VK                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page