(data stored in ACNUC7421 zone)

EMBL: AP011115.PE49

AP011115.PE49        Location/Qualifiers
FT   CDS             complement(41126..41503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48296"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS47"
FT                   /protein_id="BAH48296.1"
FT                   /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGEEVGWAA
FT                   SPLSDDEVYDASNYLFKEGYVTGMPVKDVGIPRPMLTLVGRRVAKTGNPLRSKANARDA
FT                   KPRRRPGTFAEASVTTAGTAK"
     MSAATDRQWA VRDAVLRWLL AKTTEGYRSP ILDADAIGEE VGWAASPLSD DEVYDASNYL        60
     FKEGYVTGMP VKDVGIPRPM LTLVGRRVAK TGNPLRSKAN ARDAKPRRRP GTFAEASVTT       120
     AGTAK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page