(data stored in ACNUC7421 zone)

EMBL: AP011115.PE490

AP011115.PE490       Location/Qualifiers
FT   CDS             499472..499678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48737"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR0"
FT                   /protein_id="BAH48737.1"
FT                   /translation="MNDDQRRALEHVRDTCAMLHCFLTTHSSDRPPERVRTATFEQLTD
FT                   DLLDAVTSAQNVGVPEQRIFDSM"
     MNDDQRRALE HVRDTCAMLH CFLTTHSSDR PPERVRTATF EQLTDDLLDA VTSAQNVGVP        60
     EQRIFDSM                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page