(data stored in ACNUC7421 zone)

EMBL: AP011115.PE491

AP011115.PE491       Location/Qualifiers
FT   CDS             499675..501162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48738"
FT                   /db_xref="GOA:C1ARR1"
FT                   /db_xref="InterPro:IPR024026"
FT                   /db_xref="InterPro:IPR024740"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038546"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR1"
FT                   /protein_id="BAH48738.1"
FT                   /translation="MTDDLHRPGRKSECGAGPAYGRLCLVILTISTTARPATDLGYLLH
FT                   KHPDRVQEFTQSCGVARVFYPEANENRCTVALLLDVDATRLARSSGRSADYALGQYVND
FT                   RPYAVSSLLSVALADVFRTARAGRCTLQPELAATPIPLEISLPALPCSGGPELAEQLFT
FT                   PMGWTVEARPVRLDDAFPEWGDSRYVRLTLRGDIRLADALNHLYVLLPVLDDAKHYWVA
FT                   SDEVDKLIRAGGSWLAEHPERTLITRRYLRHQTALTRSAFERLAELGDDVAEQLEPPVD
FT                   EEPGNDTVAAAPPLNVIRREAVLGALGELDARTVIDLGCGSGQLVSALLDDARFTEIAA
FT                   ADVSTRALSIAARRLQLDRMPERRRERLQLFQAALTYTDSRFAGYDAAVLMEVIEHIDP
FT                   PRLTALEQVIFVTARPGHVIVTTPNSEYNVRYPDLVGMRHRDHRFEWSRAEFRSWAGNV
FT                   CQVHGYTADFRPVGDDDPEVGPPTQMAVFTRAGGAHD"
     MTDDLHRPGR KSECGAGPAY GRLCLVILTI STTARPATDL GYLLHKHPDR VQEFTQSCGV        60
     ARVFYPEANE NRCTVALLLD VDATRLARSS GRSADYALGQ YVNDRPYAVS SLLSVALADV       120
     FRTARAGRCT LQPELAATPI PLEISLPALP CSGGPELAEQ LFTPMGWTVE ARPVRLDDAF       180
     PEWGDSRYVR LTLRGDIRLA DALNHLYVLL PVLDDAKHYW VASDEVDKLI RAGGSWLAEH       240
     PERTLITRRY LRHQTALTRS AFERLAELGD DVAEQLEPPV DEEPGNDTVA AAPPLNVIRR       300
     EAVLGALGEL DARTVIDLGC GSGQLVSALL DDARFTEIAA ADVSTRALSI AARRLQLDRM       360
     PERRRERLQL FQAALTYTDS RFAGYDAAVL MEVIEHIDPP RLTALEQVIF VTARPGHVIV       420
     TTPNSEYNVR YPDLVGMRHR DHRFEWSRAE FRSWAGNVCQ VHGYTADFRP VGDDDPEVGP       480
     PTQMAVFTRA GGAHD                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page