(data stored in ACNUC7421 zone)

EMBL: AP011115.PE495

AP011115.PE495       Location/Qualifiers
FT   CDS             504522..505031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48742"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR5"
FT                   /protein_id="BAH48742.1"
FT                   /translation="MLIYSMSVEEDGFIADREGGFGWTVPTRSTRQRPSQCPARRGAAN
FT                   DPSMTSRFSSNLVRGIIVATSVLTAACSSGGAERSAPLVGVETSTAPATPDTPGTLPTA
FT                   NELTALYNTALDYDVPLSDRVNLIQGVDEADPRLAQKFVQEEMTVAFHAVLDRGDGSLL
FT                   AFGNPS"
     MLIYSMSVEE DGFIADREGG FGWTVPTRST RQRPSQCPAR RGAANDPSMT SRFSSNLVRG        60
     IIVATSVLTA ACSSGGAERS APLVGVETST APATPDTPGT LPTANELTAL YNTALDYDVP       120
     LSDRVNLIQG VDEADPRLAQ KFVQEEMTVA FHAVLDRGDG SLLAFGNPS                   169
//

If you have problems or comments...

PBIL Back to PBIL home page