(data stored in ACNUC7421 zone)

EMBL: AP011115.PE5

AP011115.PE5         Location/Qualifiers
FT   CDS             3160..3567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48252"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS03"
FT                   /protein_id="BAH48252.1"
FT                   /translation="MGRTRPCDQAVRRGRLKKAEQFFHLAEIGRDFADEPDGVDDAVVT
FT                   LWVHAGIAASDVICCARLGKHAQGEDHKDAVTVLGSVDPTTAKHLSVLLGLKTRSGYTD
FT                   MPTSRTESKRAERAAEALIEAARRAHAQAGT"
     MGRTRPCDQA VRRGRLKKAE QFFHLAEIGR DFADEPDGVD DAVVTLWVHA GIAASDVICC        60
     ARLGKHAQGE DHKDAVTVLG SVDPTTAKHL SVLLGLKTRS GYTDMPTSRT ESKRAERAAE       120
     ALIEAARRAH AQAGT                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page