(data stored in ACNUC7421 zone)

EMBL: AP011115.PE502

AP011115.PE502       Location/Qualifiers
FT   CDS             complement(512316..513503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48749"
FT                   /db_xref="GOA:C1ARS2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS2"
FT                   /protein_id="BAH48749.1"
FT                   /translation="MNLIDQHAAVLPTDAANATLVGRVHDDAIGGPCIVTLRSGAVVDI
FT                   TDAFPTMTDLLESPDPVKAVRSAVGTRSWPIADVLASSLTARTTAPYLLAPVDLSVLKA
FT                   AGVTFATSLLERLIEERAGGDPEQADAIRGDFERLIGSTLSSIEPGSEDAARLKEDLKS
FT                   RGQWSQYLEVGLGPDPEVFTKAPVLSAVGCGSEIGVAQVSSWNNPEPEVALAVTSTGRI
FT                   VGAMLGNDVNLRDVEGRSALLLPKAKDNNASASLGPFIRLLDESFTLDDVRAAEVRLQV
FT                   LGEDDGFVLDDVSYMREISRDISTLAEYTVGDAHQYPDGIVLYTGTLFSPTHDRGGEGM
FT                   GFTHHIGDVVRISSPKLGTLVNRVNHSEKAQRWEFGLRSFIANLHGRGLVGKVGA"
     MNLIDQHAAV LPTDAANATL VGRVHDDAIG GPCIVTLRSG AVVDITDAFP TMTDLLESPD        60
     PVKAVRSAVG TRSWPIADVL ASSLTARTTA PYLLAPVDLS VLKAAGVTFA TSLLERLIEE       120
     RAGGDPEQAD AIRGDFERLI GSTLSSIEPG SEDAARLKED LKSRGQWSQY LEVGLGPDPE       180
     VFTKAPVLSA VGCGSEIGVA QVSSWNNPEP EVALAVTSTG RIVGAMLGND VNLRDVEGRS       240
     ALLLPKAKDN NASASLGPFI RLLDESFTLD DVRAAEVRLQ VLGEDDGFVL DDVSYMREIS       300
     RDISTLAEYT VGDAHQYPDG IVLYTGTLFS PTHDRGGEGM GFTHHIGDVV RISSPKLGTL       360
     VNRVNHSEKA QRWEFGLRSF IANLHGRGLV GKVGA                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page