(data stored in ACNUC7421 zone)

EMBL: AP011115.PE504

AP011115.PE504       Location/Qualifiers
FT   CDS             complement(514297..515343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05040"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48751"
FT                   /db_xref="GOA:C1ARS4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS4"
FT                   /protein_id="BAH48751.1"
FT                   /translation="MTVQRAPGRPAGAFKRIFTDYGIVIALIAIIGFFSVMRPDTFPTV
FT                   ANFGSILQANASIMFIAFGLMLPLIVGHFDLSVAAMAGFGGVLATGLMSNGTVSQWPLA
FT                   VLIVVVVAVVVGLINGFLVAYLNLNALVVTLGTQSVLFGAILWYSKGAVIYSGIPQSFK
FT                   DLGQDRPLGIPLPFIFAVAVGIVLWYVLYYRPVGRRLYAIGGSRDAARLTGIKVDQLTV
FT                   GAFVGGAVLAAVGGVLQVAQVGSAAPTSGSEFLLPAIAACFLGETSIRRGYYNVWGTMT
FT                   AVVLVAAGTTGLFMLGAQTWVQPVFNGVVLVGAILAAKVGVLKTRARKARPPATTAPPT
FT                   PTVVAAAH"
     MTVQRAPGRP AGAFKRIFTD YGIVIALIAI IGFFSVMRPD TFPTVANFGS ILQANASIMF        60
     IAFGLMLPLI VGHFDLSVAA MAGFGGVLAT GLMSNGTVSQ WPLAVLIVVV VAVVVGLING       120
     FLVAYLNLNA LVVTLGTQSV LFGAILWYSK GAVIYSGIPQ SFKDLGQDRP LGIPLPFIFA       180
     VAVGIVLWYV LYYRPVGRRL YAIGGSRDAA RLTGIKVDQL TVGAFVGGAV LAAVGGVLQV       240
     AQVGSAAPTS GSEFLLPAIA ACFLGETSIR RGYYNVWGTM TAVVLVAAGT TGLFMLGAQT       300
     WVQPVFNGVV LVGAILAAKV GVLKTRARKA RPPATTAPPT PTVVAAAH                    348
//

If you have problems or comments...

PBIL Back to PBIL home page