(data stored in ACNUC7421 zone)

EMBL: AP011115.PE505

AP011115.PE505       Location/Qualifiers
FT   CDS             complement(515372..516958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05050"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48752"
FT                   /db_xref="GOA:C1ARS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS5"
FT                   /protein_id="BAH48752.1"
FT                   /translation="MVPDQETRTAMTSNDSSPTPSIEIIALSKEFGVNRVLDNVNLEFR
FT                   PGSINALLGANGSGKSTLIKLLAGYHTPTSGTIRVHGDELALPADPTVLHDAGVRFVHQ
FT                   DLGLIESMSIADNLALALGYEKRAATINWRRQRATAVADLAAVGLDDLDPRALVGALGP
FT                   VQQTLVAMARALRGLQPGRGVLVLDEPTARLPNAQVDELLTRCRLLRDQGIALIYVSHR
FT                   LDEVFAMADRVSVLRDGRLVFDDVIAATDDQHLTQIITGGATTDETADHPAPARRVVDP
FT                   GTPPKLALRGVCGTFVQDVDLDLRPGEVLAVTGLVGSGRSELGRLIFGSQAITAGEVRL
FT                   RGQQLRRISPKLSIERGIGYVPQDRKQSAIPSFTLADNLCLASLDKHMSAGLLSAESER
FT                   TVTASAIERLDVRPADPERLLGELSGGNQQKIVLGKWLELDLDVLILDEPTYGVDVGAR
FT                   KTILEAVLEQVGRRQLSVLLLDSDIDLVARYADRVLVMRRGRIATELVGAEITTERIAA
FT                   ASYAVQDLSTA"
     MVPDQETRTA MTSNDSSPTP SIEIIALSKE FGVNRVLDNV NLEFRPGSIN ALLGANGSGK        60
     STLIKLLAGY HTPTSGTIRV HGDELALPAD PTVLHDAGVR FVHQDLGLIE SMSIADNLAL       120
     ALGYEKRAAT INWRRQRATA VADLAAVGLD DLDPRALVGA LGPVQQTLVA MARALRGLQP       180
     GRGVLVLDEP TARLPNAQVD ELLTRCRLLR DQGIALIYVS HRLDEVFAMA DRVSVLRDGR       240
     LVFDDVIAAT DDQHLTQIIT GGATTDETAD HPAPARRVVD PGTPPKLALR GVCGTFVQDV       300
     DLDLRPGEVL AVTGLVGSGR SELGRLIFGS QAITAGEVRL RGQQLRRISP KLSIERGIGY       360
     VPQDRKQSAI PSFTLADNLC LASLDKHMSA GLLSAESERT VTASAIERLD VRPADPERLL       420
     GELSGGNQQK IVLGKWLELD LDVLILDEPT YGVDVGARKT ILEAVLEQVG RRQLSVLLLD       480
     SDIDLVARYA DRVLVMRRGR IATELVGAEI TTERIAAASY AVQDLSTA                    528
//

If you have problems or comments...

PBIL Back to PBIL home page