(data stored in ACNUC7421 zone)

EMBL: AP011115.PE506

AP011115.PE506       Location/Qualifiers
FT   CDS             complement(516962..518074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48753"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS6"
FT                   /protein_id="BAH48753.1"
FT                   /translation="MTGCSAAPSDRSAVDPAARNAAVDKAQRGAAELLDAGLHDNHWTG
FT                   PETSPPPRQGLEITIIPEQMASTGSSRPAKAIESEVKKLGWVPKISDGQGKPEVQLNAL
FT                   NTAVDEKVDAVILIFVDTTRVQSALQRALAAGVKVVTLGSLKNTPDTVPDVSFDWVRAG
FT                   ESIAQYAVWKSGGDLGMLQMRNADLYIVVNGQYKGSQSYLDAPGNCPGCDVVTQDWSLA
FT                   TFEDPTIGPAAQAVATRLANPQLNWVSCFDSCLFRVSNGLNRAGFSGKVSGAGFDCNPE
FT                   NLDIIRAGGVQKVCFADPREWLAYAAIDNINRMTNGLPAFNFTESIPVALFDKDSLSQL
FT                   APDRSAELETKGWQGNYDFRAKFEQLWGIG"
     MTGCSAAPSD RSAVDPAARN AAVDKAQRGA AELLDAGLHD NHWTGPETSP PPRQGLEITI        60
     IPEQMASTGS SRPAKAIESE VKKLGWVPKI SDGQGKPEVQ LNALNTAVDE KVDAVILIFV       120
     DTTRVQSALQ RALAAGVKVV TLGSLKNTPD TVPDVSFDWV RAGESIAQYA VWKSGGDLGM       180
     LQMRNADLYI VVNGQYKGSQ SYLDAPGNCP GCDVVTQDWS LATFEDPTIG PAAQAVATRL       240
     ANPQLNWVSC FDSCLFRVSN GLNRAGFSGK VSGAGFDCNP ENLDIIRAGG VQKVCFADPR       300
     EWLAYAAIDN INRMTNGLPA FNFTESIPVA LFDKDSLSQL APDRSAELET KGWQGNYDFR       360
     AKFEQLWGIG                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page