(data stored in ACNUC7421 zone)

EMBL: AP011115.PE51

AP011115.PE51        Location/Qualifiers
FT   CDS             43113..43325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48298"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS49"
FT                   /protein_id="BAH48298.1"
FT                   /translation="MYRSRTPAAAIHRSFAHGGSMSTRQIKAHLEVMFAPETDHGTPPE
FT                   NAGSVFAHQLSEAEENTALPLADIA"
     MYRSRTPAAA IHRSFAHGGS MSTRQIKAHL EVMFAPETDH GTPPENAGSV FAHQLSEAEE        60
     NTALPLADIA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page