(data stored in ACNUC7421 zone)

EMBL: AP011115.PE518

AP011115.PE518       Location/Qualifiers
FT   CDS             534152..535015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05180"
FT                   /product="putative inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48765"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART8"
FT                   /protein_id="BAH48765.1"
FT                   /translation="MIRIAGAPISWGVCEVPGWGHQLGSERVLTEMRDAGLEAAEIGPE
FT                   GFLPADPQELAATLASYDLEAVGGFTPVLLHDPDHDPVPDITGALAAFTAAGAEVLVLA
FT                   AITGTDGYDSRPDLDDAGWKTLLSNLDRLHDVAADQGIRAVLHPHVGTMIEKNIEVERV
FT                   LDGSSIPLCLDTGHLLIGGTDPLELARAAADRITHTHLKDVDAEFAARVQAGELTYTDA
FT                   VAQGMYTPLGTGDVDVAGVVRHLVASGFDGWFTLEQDTILTGEPEGEGPVADVKTSAAF
FT                   LRSLQL"
     MIRIAGAPIS WGVCEVPGWG HQLGSERVLT EMRDAGLEAA EIGPEGFLPA DPQELAATLA        60
     SYDLEAVGGF TPVLLHDPDH DPVPDITGAL AAFTAAGAEV LVLAAITGTD GYDSRPDLDD       120
     AGWKTLLSNL DRLHDVAADQ GIRAVLHPHV GTMIEKNIEV ERVLDGSSIP LCLDTGHLLI       180
     GGTDPLELAR AAADRITHTH LKDVDAEFAA RVQAGELTYT DAVAQGMYTP LGTGDVDVAG       240
     VVRHLVASGF DGWFTLEQDT ILTGEPEGEG PVADVKTSAA FLRSLQL                     287
//

If you have problems or comments...

PBIL Back to PBIL home page