(data stored in ACNUC7421 zone)

EMBL: AP011115.PE520

AP011115.PE520       Location/Qualifiers
FT   CDS             536146..537174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05200"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48767"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU0"
FT                   /protein_id="BAH48767.1"
FT                   /translation="MDTHNGPNASVPRKLPSRATALALSVAAAVLLAGCSSTGGKPEST
FT                   GGGMASGTADTPRATIAMITHEVPGDTFWDLIRKGAETAAAKDNIELRYSADPEAPNQA
FT                   NLVQSAIDSRVDGIAVTLAKPDAMAPAVRAAVDAGTPVVAFNGGMDQYKSLGVPQYFGQ
FT                   DEKLAGISAGQRLTADGAKKALCIIQEQGQVALETRCAGVIEGFKGQTEILNVNSKDMP
FT                   SVEATITAKLQQDPSIDHVVALGAPIALTAVQSKANANSSATIVTFDTNAALVDAIKAG
FT                   DVQWAIDQQPFLQGYLAVDSLWLYLNNRNTIGGGMPTLTGPAFIDQSNIDSIAEYAQAG
FT                   TR"
     MDTHNGPNAS VPRKLPSRAT ALALSVAAAV LLAGCSSTGG KPESTGGGMA SGTADTPRAT        60
     IAMITHEVPG DTFWDLIRKG AETAAAKDNI ELRYSADPEA PNQANLVQSA IDSRVDGIAV       120
     TLAKPDAMAP AVRAAVDAGT PVVAFNGGMD QYKSLGVPQY FGQDEKLAGI SAGQRLTADG       180
     AKKALCIIQE QGQVALETRC AGVIEGFKGQ TEILNVNSKD MPSVEATITA KLQQDPSIDH       240
     VVALGAPIAL TAVQSKANAN SSATIVTFDT NAALVDAIKA GDVQWAIDQQ PFLQGYLAVD       300
     SLWLYLNNRN TIGGGMPTLT GPAFIDQSNI DSIAEYAQAG TR                          342
//

If you have problems or comments...

PBIL Back to PBIL home page