(data stored in ACNUC7421 zone)

EMBL: AP011115.PE528

AP011115.PE528       Location/Qualifiers
FT   CDS             545546..545902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48775"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU8"
FT                   /protein_id="BAH48775.1"
FT                   /translation="MTVLVAVTDTPEGAQALIAGKEEAERLGTTLLVLNLSLSEFPPTE
FT                   LAIADEADILDRSGRQARDPAVTVLDLIQERPDIERLVIGVKRRSRVGKALLGSISQRL
FT                   ILHSPVPVLAVKNE"
     MTVLVAVTDT PEGAQALIAG KEEAERLGTT LLVLNLSLSE FPPTELAIAD EADILDRSGR        60
     QARDPAVTVL DLIQERPDIE RLVIGVKRRS RVGKALLGSI SQRLILHSPV PVLAVKNE         118
//

If you have problems or comments...

PBIL Back to PBIL home page