(data stored in ACNUC7421 zone)

EMBL: AP011115.PE529

AP011115.PE529       Location/Qualifiers
FT   CDS             complement(546153..546680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48776"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU9"
FT                   /protein_id="BAH48776.1"
FT                   /translation="MRKSLLIVALIASWSVAGAVPAGAAPMQPSWSGEYSLKRFAATKT
FT                   GTSLAARQWEPDFADTYRFETSCTDDSCVATVTDGPTPANPTLPLPPRYIWDGTSWVHT
FT                   YDWEWDCYQGEGVPKVWAPAHSVAYYTPQPDGTLTGSWRTDIDGGPCEGSVIMDVAAYP
FT                   VEPPPGPFGSSW"
     MRKSLLIVAL IASWSVAGAV PAGAAPMQPS WSGEYSLKRF AATKTGTSLA ARQWEPDFAD        60
     TYRFETSCTD DSCVATVTDG PTPANPTLPL PPRYIWDGTS WVHTYDWEWD CYQGEGVPKV       120
     WAPAHSVAYY TPQPDGTLTG SWRTDIDGGP CEGSVIMDVA AYPVEPPPGP FGSSW            175
//

If you have problems or comments...

PBIL Back to PBIL home page