(data stored in ACNUC7421 zone)

EMBL: AP011115.PE530

AP011115.PE530       Location/Qualifiers
FT   CDS             546965..547594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48777"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV0"
FT                   /protein_id="BAH48777.1"
FT                   /translation="MSTSETWTADFANRAARRAAEPDPDWSRGCRRHPAVARLGCLRRC
FT                   YAPPVSRPWVGTGPTPYLCICVCREALRLELMVVTVAEVVALRYYRALADGGGDALPAE
FT                   VSNRILDDERHHVPFQSRRLSTGFAHTPAPARAAIGRIWRALAFAVAMVVAWNHGPALR
FT                   VLGVTRRTFVSDTKRLFDNAAAEAMHTQRNRPPHACQSAVLRGSGP"
     MSTSETWTAD FANRAARRAA EPDPDWSRGC RRHPAVARLG CLRRCYAPPV SRPWVGTGPT        60
     PYLCICVCRE ALRLELMVVT VAEVVALRYY RALADGGGDA LPAEVSNRIL DDERHHVPFQ       120
     SRRLSTGFAH TPAPARAAIG RIWRALAFAV AMVVAWNHGP ALRVLGVTRR TFVSDTKRLF       180
     DNAAAEAMHT QRNRPPHACQ SAVLRGSGP                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page