(data stored in ACNUC7421 zone)

EMBL: AP011115.PE531

AP011115.PE531       Location/Qualifiers
FT   CDS             548077..549159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48778"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV1"
FT                   /protein_id="BAH48778.1"
FT                   /translation="MLDDAATGRFAVVPVVARSVGAGFGVAWIEREVSVVGVRVETVGE
FT                   GEPIGLDDVDTRVRWLLDLISGAEAQMLSRLWQPATFDVLAAGVDRQGRKLATQGHVAA
FT                   ARLGWTPHYPDGVYVPSRVTRVVTAQVMASLRTLAFRDTAIASLSERFDPATGRIAPPT
FT                   AAADWMPPGFARGVRRQLIARARRDGDAVPSGRLRITDMQAPPQTSAMARLSAADRQLA
FT                   QLTVAERELVLTVKLPTTPAPTGRAQWRSVRLTAAIPAHLHGRAITDWHLPTLVLDKKG
FT                   LLLRCAATELVPSGDLGSATVAVGWIGPRPRSVPPPSPPTARRGWSRTFGVSRTTTAAS
FT                   GPNSPACRPKASCCTARPPG"
     MLDDAATGRF AVVPVVARSV GAGFGVAWIE REVSVVGVRV ETVGEGEPIG LDDVDTRVRW        60
     LLDLISGAEA QMLSRLWQPA TFDVLAAGVD RQGRKLATQG HVAAARLGWT PHYPDGVYVP       120
     SRVTRVVTAQ VMASLRTLAF RDTAIASLSE RFDPATGRIA PPTAAADWMP PGFARGVRRQ       180
     LIARARRDGD AVPSGRLRIT DMQAPPQTSA MARLSAADRQ LAQLTVAERE LVLTVKLPTT       240
     PAPTGRAQWR SVRLTAAIPA HLHGRAITDW HLPTLVLDKK GLLLRCAATE LVPSGDLGSA       300
     TVAVGWIGPR PRSVPPPSPP TARRGWSRTF GVSRTTTAAS GPNSPACRPK ASCCTARPPG       360
//

If you have problems or comments...

PBIL Back to PBIL home page