(data stored in ACNUC7421 zone)

EMBL: AP011115.PE532

AP011115.PE532       Location/Qualifiers
FT   CDS             549132..549869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48779"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV2"
FT                   /protein_id="BAH48779.1"
FT                   /translation="MLHRKAARLTQLATNAEPEARTQLEAKIAVLNEHRTAAGAKRVKI
FT                   NRELGFHFARQTADYATAAGATVIAVEDLTTLETRGHGRVNNNRAAQSARRKAITALAH
FT                   TAASVGITVVSVPARGSSAQCPGCDAPLARPDGYHTAWCSGCRVGGNRDHIAGVNLAKR
FT                   ALLGKGKVTRRRGQMPAVRVAEHAPVRRSRDKTGPTPRRPRHRRVRRSLPTVTPRAGVT
FT                   PKQICSCTSSVGVGHGPTRTTSR"
     MLHRKAARLT QLATNAEPEA RTQLEAKIAV LNEHRTAAGA KRVKINRELG FHFARQTADY        60
     ATAAGATVIA VEDLTTLETR GHGRVNNNRA AQSARRKAIT ALAHTAASVG ITVVSVPARG       120
     SSAQCPGCDA PLARPDGYHT AWCSGCRVGG NRDHIAGVNL AKRALLGKGK VTRRRGQMPA       180
     VRVAEHAPVR RSRDKTGPTP RRPRHRRVRR SLPTVTPRAG VTPKQICSCT SSVGVGHGPT       240
     RTTSR                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page