(data stored in ACNUC7421 zone)

EMBL: AP011115.PE533

AP011115.PE533       Location/Qualifiers
FT   CDS             550113..550691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48780"
FT                   /db_xref="GOA:C1ARV3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV3"
FT                   /protein_id="BAH48780.1"
FT                   /translation="MTATYTFDVFSSLDGYGGVSGGDWGGYWGKQGPELLDHRLALYDS
FT                   EQRMIFGANTYRAFAQMLASSTEESEVRDPWVTRMRSLPATVVSTTLEGPLDWPDATIV
FT                   SGDAVDIVARLKQESDVPLRSHGSLSMNRALMAAGLVDRLQVTLFPVITGKTGDDPIFQ
FT                   GAADFDLELLENRTLDGDIQELIYRPTLH"
     MTATYTFDVF SSLDGYGGVS GGDWGGYWGK QGPELLDHRL ALYDSEQRMI FGANTYRAFA        60
     QMLASSTEES EVRDPWVTRM RSLPATVVST TLEGPLDWPD ATIVSGDAVD IVARLKQESD       120
     VPLRSHGSLS MNRALMAAGL VDRLQVTLFP VITGKTGDDP IFQGAADFDL ELLENRTLDG       180
     DIQELIYRPT LH                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page