(data stored in ACNUC7421 zone)

EMBL: AP011115.PE535

AP011115.PE535       Location/Qualifiers
FT   CDS             552196..552636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48782"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV5"
FT                   /protein_id="BAH48782.1"
FT                   /translation="MTFKRMDHVSVIVDDLESAIAFFVELGMEQEGGAQIEGPWVDRVN
FT                   GLDDVRVDIPMMRTPDGHGRLELTKFHNPTAISAEPENAMGNTLGLRSVMFAVDDIDAT
FT                   VAGLRARGAELVGEVAQYQDSYRLCYLRGPAGIIVALAEELG"
     MTFKRMDHVS VIVDDLESAI AFFVELGMEQ EGGAQIEGPW VDRVNGLDDV RVDIPMMRTP        60
     DGHGRLELTK FHNPTAISAE PENAMGNTLG LRSVMFAVDD IDATVAGLRA RGAELVGEVA       120
     QYQDSYRLCY LRGPAGIIVA LAEELG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page