(data stored in ACNUC7421 zone)

EMBL: AP011115.PE536

AP011115.PE536       Location/Qualifiers
FT   CDS             552720..553472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48783"
FT                   /db_xref="GOA:C1ARV6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV6"
FT                   /protein_id="BAH48783.1"
FT                   /translation="MADPMHFEAHAEIYGEARPPYPPALWDYLHGLGVLERGRRALDIG
FT                   AGTGQATGPLLAAGLDVTAVEPGPRLAARLRRAHPDAVVINERAEDVELPDSGFDIAIA
FT                   ATSIHWIDLDIVLPKIHRALTPDGKFLVWRNVFGDPETRTPFRERVARIVQDRGASPRV
FT                   GPDPDDVAALSEELTRSSLFSVDVVRTFRWNIELNDRQVFRLFSTFSDWTSEEADRAAA
FT                   AVRELGGTVVEHYTTWLVALTPTPATTR"
     MADPMHFEAH AEIYGEARPP YPPALWDYLH GLGVLERGRR ALDIGAGTGQ ATGPLLAAGL        60
     DVTAVEPGPR LAARLRRAHP DAVVINERAE DVELPDSGFD IAIAATSIHW IDLDIVLPKI       120
     HRALTPDGKF LVWRNVFGDP ETRTPFRERV ARIVQDRGAS PRVGPDPDDV AALSEELTRS       180
     SLFSVDVVRT FRWNIELNDR QVFRLFSTFS DWTSEEADRA AAAVRELGGT VVEHYTTWLV       240
     ALTPTPATTR                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page