(data stored in ACNUC7421 zone)

EMBL: AP011115.PE54

AP011115.PE54        Location/Qualifiers
FT   CDS             complement(44768..45133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00540"
FT                   /product="putative WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48301"
FT                   /db_xref="GOA:C1AS52"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS52"
FT                   /protein_id="BAH48301.1"
FT                   /translation="MNGWRAAAPNCRCSFSPDGERRGAPDRCEARARQICQVCPGLVRC
FT                   RDHALTSGESYGVWGGMTESDRRKHTNRSRRGERRPLGSFQERPVGAASGVRGATFTGS
FT                   YGGAYTGGASRGRPTAR"
     MNGWRAAAPN CRCSFSPDGE RRGAPDRCEA RARQICQVCP GLVRCRDHAL TSGESYGVWG        60
     GMTESDRRKH TNRSRRGERR PLGSFQERPV GAASGVRGAT FTGSYGGAYT GGASRGRPTA       120
     R                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page