(data stored in ACNUC7421 zone)

EMBL: AP011115.PE542

AP011115.PE542       Location/Qualifiers
FT   CDS             complement(559359..559751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48789"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW2"
FT                   /protein_id="BAH48789.1"
FT                   /translation="MRFVAAVSDGFGKARIASLGTADAPAKRGASRRVGGSAGLAAMVE
FT                   PGALQIQERRALGICSLLPAGDVVPNGSRTSVKFRRSAVGVLVVEKMGGRAIAPNQQLF
FT                   IGETRRRSFVELRDRDVLHELQRDTQ"
     MRFVAAVSDG FGKARIASLG TADAPAKRGA SRRVGGSAGL AAMVEPGALQ IQERRALGIC        60
     SLLPAGDVVP NGSRTSVKFR RSAVGVLVVE KMGGRAIAPN QQLFIGETRR RSFVELRDRD       120
     VLHELQRDTQ                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page