(data stored in ACNUC7421 zone)

EMBL: AP011115.PE543

AP011115.PE543       Location/Qualifiers
FT   CDS             complement(559726..560559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48790"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW3"
FT                   /protein_id="BAH48790.1"
FT                   /translation="MGTSRLGDVELTYQLRERGERVVLVHASAFASWYDPLIEQLTAYS
FT                   TLRYRRRLRKSDSGVYRALTVAEDAGTCVSVMDHVGWDAAHIVGHSYGALVALQLATEN
FT                   PGRVGSVALLEPAIRGVASSEQIIVALQPVIAAYRSGDKAAAVDGFLRHVCGDGYRGVL
FT                   DRMVPHAFDDALEEADLFFQSELPAVQQWSFGAAESERITQPVLNVLGAESAPRFVEGS
FT                   ELLQSWFPRAERLSVPKAGHLLMVQNPTAVARGLKDFFSRHPIDQVGSALRRRSL"
     MGTSRLGDVE LTYQLRERGE RVVLVHASAF ASWYDPLIEQ LTAYSTLRYR RRLRKSDSGV        60
     YRALTVAEDA GTCVSVMDHV GWDAAHIVGH SYGALVALQL ATENPGRVGS VALLEPAIRG       120
     VASSEQIIVA LQPVIAAYRS GDKAAAVDGF LRHVCGDGYR GVLDRMVPHA FDDALEEADL       180
     FFQSELPAVQ QWSFGAAESE RITQPVLNVL GAESAPRFVE GSELLQSWFP RAERLSVPKA       240
     GHLLMVQNPT AVARGLKDFF SRHPIDQVGS ALRRRSL                                277
//

If you have problems or comments...

PBIL Back to PBIL home page